The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of prokaryotic transcription elongation factor GreA/GreB from Nitrosomonas europaea. To be Published
    Site MCSG
    PDB Id 2pn0 Target Id APC6349
    Molecular Characteristics
    Source Nitrosomonas europaea atcc 19718
    Alias Ids TPS5082,NP_842134.1, 228410 Molecular Weight 15135.40 Da.
    Residues 137 Isoelectric Point 4.50
    Sequence msikpkimissldaerleilletlsqnafpgrddleaelaraevvdpeeipptvvtmnstvrfrvessa eefcltlvypkdvdtsgekisilapvgsallglaqgdeiewpkpgggvlrvrivevtyqpersgeyyr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.70 Rfree 0.2055
    Matthews' coefficent 2.11 Rfactor 0.1766
    Waters 571 Solvent Content 41.84

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch