.
The Open Protein Structure Annotation Network
PDB Keyword
.

2phn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of an Amide Bond Forming F(420):gammagamma-glutamyl Ligase from Archaeoglobus Fulgidus - A Member of a New Family of Non-ribosomal Peptide Synthases. J.Mol.Biol. 372 456-469 2007
    Site MCSG
    PDB Id 2phn Target Id APC5730
    Related PDB Ids 2g9i 
    Molecular Characteristics
    Source Archaeoglobus fulgidus dsm 4304
    Alias Ids TPS4787,AAB89001.1, PF01996, 224325 Molecular Weight 27259.91 Da.
    Residues 249 Isoelectric Point 4.88
    Sequence mrvevfpveglplikegddlaelissrvrfedgdvlvvcstviskaegrirrleefnpserakeiaari gkpaefvqavleeseevlldfpfllvkakfgnvcvnagidasnveegslllppldpdgsaeklrrrile ltgkrvgviitdtngrcfrrgvvgfaigisgvkamkdwigrkdlygrelevtvecvadeiaafanllmg eggdgipavvvrglnvagegsmeeiyrseeedvirrclkrcl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.35 Rfree 0.18997
    Matthews' coefficent 2.05 Rfactor 0.16030
    Waters 576 Solvent Content 40.13

    Ligand Information
    Ligands ACT (ACETATE) x 4;GDP (GUANOSINE-5'-DIPHOSPHATE) x 2;EDO (1,2-ETHANEDIOL) x 4;GOL (GLYCEROL) x 1
    Metals MN (MANGANESE) x 4

    Jmol

     
    Google Scholar output for 2phn
    1. Structure of an Amide Bond Forming F420:[gamma][gamma]-glutamyl Ligase from Archaeoglobus Fulgidus-A Member of a New Family of Non-ribosomal Peptide
    B Nocek, E Evdokimova, M Proudfoot - Journal of molecular , 2007 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
    2g9i.png
    No description
    33.04 kB22:13, 30 Jun 2008dweekesActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch