.
The Open Protein Structure Annotation Network
PDB Keyword
.

2pfs

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of universal stress protein from Nitrosomonas europaea. To be Published
    Site MCSG
    PDB Id 2pfs Target Id APC6354
    Molecular Characteristics
    Source Nitrosomonas europaea atcc 19718
    Alias Ids TPS5083,NP_841101.1, 228410 Molecular Weight 16400.81 Da.
    Residues 148 Isoelectric Point 5.23
    Sequence msvyhhillavdfssedsqvvqkvrnlasqigarlslihvldnipmpdtpygtaipldtettydamldv ekqklsqigntlgidpahrwlvwgepreeiiriaeqenvdlivvgshgrhglalllgstansvlhyakc dvlavrlrdd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.25 Rfree 0.25455
    Matthews' coefficent 2.14 Rfactor 0.19471
    Waters 40 Solvent Content 42.47

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 2

    Jmol

     
    Google Scholar output for 2pfs
    1. Structure and function of the universal stress protein TeaD and its role in regulating the ectoine transporter TeaABC of Halomonas elongata DSM 2581T
    ES Schweikhard, SI Kuhlmann, HJ Kunte - Biochemistry, 2010 - ACS Publications
     
    2. Ultrahigh Resolution and Full-length Pilin Structures with Insights for Filament Assembly, Pathogenic Functions, and Vaccine Potential
    S Hartung, AS Arvai, T Wood, S Kolappan - Journal of Biological , 2011 - ASBMB
     
    3. Cloning, expression, purification, crystallization and preliminary X-ray diffraction analysis of universal stress protein F (YnaF) from Salmonella typhimurium
    SR Sagurthi, RR Panigrahi, G Gowda - Section F: Structural , 2007 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch