.
The Open Protein Structure Annotation Network
PDB Keyword
.

2pc6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structures of TM0549 and NE1324--two orthologs of E. coli AHAS isozyme III small regulatory subunit. Protein Sci. 16 1360-1367 2007
    Site MCSG
    PDB Id 2pc6 Target Id APC5899
    Molecular Characteristics
    Source Nitrosomonas europaea atcc 19718
    Alias Ids TPS4911,NP_841373.1, 228410 Molecular Weight 18116.00 Da.
    Residues 163 Isoelectric Point 5.34
    Sequence mrhiisllmeneagalsrvaglfsargynieslsvaptedptlsrmtlvtngpdeiveqitkqlnklie vvklidlssegyverelmlvkvravgkdreemkrladifrgniidvtnelytieltgtrskldgflqav dcnlileiartgvsglsrgervlkl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.50 Rfree 0.27573
    Matthews' coefficent 2.84 Rfactor 0.20503
    Waters 200 Solvent Content 56.69

    Ligand Information
    Ligands SIN (SUCCINIC) x 3
    Metals CA (CALCIUM) x 3

    Jmol

     
    Google Scholar output for 2pc6
    1. Crystal structures of TM0549 and NE1324two orthologs of E. coli AHAS isozyme III small regulatory subunit
    JJ Petkowski, M Chruszcz, MD Zimmerman - Protein , 2007 - Wiley Online Library
     
    2. Expression, purification and preliminary crystallographic analysis of Rv3002c, the regulatory subunit of acetolactate synthase (IlvH) from Mycobacterium tuberculosis
    J Yin, G Garen, C Garen, MNG James - Crystallographica Section F: , 2011 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch