.
The Open Protein Structure Annotation Network
PDB Keyword
.

2oi8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of tetR family protein SCO4313. To be Published
    Site MCSG
    PDB Id 2oi8 Target Id APC6291
    Molecular Characteristics
    Source Streptomyces coelicolor a3
    Alias Ids TPS5065,NP_628485.1, 100226 Molecular Weight 23410.90 Da.
    Residues 216 Isoelectric Point 5.20
    Sequence mpeartstpreryrtqvraeikdhaweqiatagasalslnaiakrmgmsgpalyryfdgrdelitelir dayrsqadslraaaasgadlaglahalrawalddpqryflifgtpvpgyrapdditeiaaetmavivda caalppsdgtdgafdahldthrqwagdrpapssalhralsfwsrlhgvlslelagqftgmgfdsallfe aelkdllgp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.50 Rfree 0.29934
    Matthews' coefficent 2.45 Rfactor 0.2431
    Waters 43 Solvent Content 49.78

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2oi8
    1. A comprehensive analysis of structural and sequence conservation in the TetR family transcriptional regulators
    Z Yu, SE Reichheld, A Savchenko, J Parkinson - Journal of molecular , 2010 - Elsevier
     
    2. New insights into the structure, function and evolution of TETR family transcriptional regulators
    Z Yu - 2010 - 142.150.190.46
     
    3. Mutual information and variants for protein domain-domain contact prediction
    M Gomes, R Hamer, G Reinert - BMC Research , 2012 - biomedcentral.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch