.
The Open Protein Structure Annotation Network
PDB Keyword
.

2oer

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Probable Transcriptional Regulator from Pseudomonas aeruginosa. To be Published
    Site MCSG
    PDB Id 2oer Target Id APC5932
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS4941,NP_250094.1, 208964 Molecular Weight 23326.06 Da.
    Residues 210 Isoelectric Point 5.55
    Sequence msdkrnprissrkqpqqarsselvasileaavqvlasegaqrfttarvaeragvsigslyqyfpnkaai lfrlqsdewrrttrllgeiledttrpplerlrrlvlafvrseceeaairvalsdaaplyrdadearevk aegarvfqaflrealpevaeaerslagdlltttlgavgkqfseqprseaeieryaealadmlcaylaal ger
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.29322
    Matthews' coefficent 2.08 Rfactor 0.21159
    Waters 200 Solvent Content 40.88

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2oer
    1. A comprehensive analysis of structural and sequence conservation in the TetR family transcriptional regulators
    Z Yu, SE Reichheld, A Savchenko, J Parkinson - Journal of molecular , 2010 - Elsevier
     
    2. New insights into the structure, function and evolution of TETR family transcriptional regulators
    Z Yu - 2010 - 142.150.190.46
     
    3. Crystal structure of a putative transcriptional regulator SCO0520 from Streptomyces coelicolorA3 (2) reveals an unusual dimer among TetR family proteins
    EV Filippova, M Chruszcz, M Cymborowski - Journal of structural and , 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch