.
The Open Protein Structure Annotation Network
PDB Keyword
.

2o35

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of Protein of Unknown Function (DUF1244) from Sinorhizobium meliloti. To be Published
    Site MCSG
    PDB Id 2o35 Target Id APC6310
    Molecular Characteristics
    Source Sinorhizobium meliloti 1021
    Alias Ids TPS5073,NP_386898.1, 266834 Molecular Weight 11770.47 Da.
    Residues 101 Isoelectric Point 5.14
    Sequence mseispeqrtafeaaafrrllehlrersdvqnidlmnlagfcrnclsnwyreaaeasgvpmskeesrei vygmpyeewrtqnqgeaspeqkaafernrpke
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.12 Rfree 0.26288
    Matthews' coefficent 2.48 Rfactor 0.20859
    Waters 117 Solvent Content 50.43

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 2

    Jmol

     
    Google Scholar output for 2o35
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch