The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Putative Transcriptional Regul 2 Rha1_Ro06953(Iclr-Family) from Rhodococcus Sp. To be Published
    Site MCSG
    PDB Id 2o0y Target Id APC6047
    Molecular Characteristics
    Source Rhodococcus sp. rha1
    Alias Ids TPS4990,RHA00472, 101510 Molecular Weight 27771.01 Da.
    Residues 260 Isoelectric Point 5.15
    Sequence vtavptdsaekpavadagvrsvtrvidllelfdaahptrslkelvegtklpkttvvrlvatmcarsvlt sradgsyslgpemlrwvrlagrtwappeevvdimrqlsadtgetvnlyirqglsrvvvaqcestatvrs viplgvpyplwagaagkilllaapeliddvaadsphgpefadqlrekvedgrergyqlvhgerelgssg lsfplvdshgtvvaaltlggptgrftedrtphyiectraaaeeisaiglpgld
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.23384
    Matthews' coefficent 2.59 Rfactor 0.18224
    Waters 480 Solvent Content 52.51

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch