.
The Open Protein Structure Annotation Network
PDB Keyword
.

2nzc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title The structure of uncharacterized protein TM1266 from Thermotoga maritima. TO BE PUBLISHED
    Site MCSG
    PDB Id 2nzc Target Id APC4648
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS4619,AAD36341, 2336 Molecular Weight 9461.60 Da.
    Residues 82 Isoelectric Point 9.10
    Sequence mekrfyiltivvedrekayrqvnellhnfsedillrvgypvreenmaiiflvlktdndtigalsgklgq isgvrvktvplkr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.95 Rfree 0.25943
    Matthews' coefficent 1.96 Rfactor 0.20778
    Waters 274 Solvent Content 37.37

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1;ACY (ACETIC) x 4;GOL (GLYCEROL) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch