.
The Open Protein Structure Annotation Network
PDB Keyword
.

2nwh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of carbohydrate kinase from Agrobacterium tumefaciens. To be Published
    Site MCSG
    PDB Id 2nwh Target Id APC6199
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS5030,NP_532555.1, 176299 Molecular Weight 32947.85 Da.
    Residues 313 Isoelectric Point 5.35
    Sequence mkkilvlggahidrrgmietetapgasnpgswmeeaggggfnaarnlsrlgfevriiaprggdvtgevv aeaarqagvedtpftfldrrtpsytailerdgnlvialadmdlyklftprrlkvravreaiiasdfllc danlpedtltalgliaracekplaaiaispakavklkaalgdidilfmneaearaltgetaenvrdwpn ilrkaglsggvvtrgasevvafngtekailhpplirevkdvtgagdamasgylaaiaegktirealrqg aaaaaitvqssfatsqdlskdsveamlglvpqaemla
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.86 Rfree 0.2331
    Matthews' coefficent 2.59 Rfactor 0.1936
    Waters 277 Solvent Content 52.44

    Ligand Information
    Ligands
    Metals NA (SODIUM) x 1;CA (CALCIUM) x 2;CL (CHLORIDE) x 1

    Jmol

     
    Google Scholar output for 2nwh
    1. Ribokinase family evolution and the role of conserved residues at the active site of the PfkB subfamily representative, Pfk-2 from Escherichia coli
    R Cabrera, J Babul, V Guix - Archives of biochemistry and biophysics, 2010 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch