.
The Open Protein Structure Annotation Network
PDB Keyword
.

2in3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative protein disulfide isomerase from Nitrosomonas europaea. To be Published
    Site MCSG
    PDB Id 2in3 Target Id APC5894
    Molecular Characteristics
    Source Nitrosomonas europaea atcc 19718
    Alias Ids TPS4907,NP_842542.1, 228410 Molecular Weight 23890.35 Da.
    Residues 212 Isoelectric Point 5.95
    Sequence mamekpvlwyiadpmcswcwgfapvienirqeysafltvkimpgglrpgtntpllpekraqilhhwhsv hittgqpftfenalpegfiydtepacrgvvsvsliepekvfpffaaiqrafyvgqedvaqlailkklav dlgipesrftpvfqsdeakqrtlagfqrvaqwgisgfpalvvesgtdrylittgyrpiealrqlldtwl qqhgv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.85 Rfree 0.22731
    Matthews' coefficent 2.51 Rfactor 0.1886
    Waters 180 Solvent Content 51.09

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1;EDO (1,2-ETHANEDIOL) x 4;GOL (GLYCEROL) x 1
    Metals

    Jmol

     
    Google Scholar output for 2in3
    1. Structural and functional characterization of the oxidoreductase _-DsbA1 from Wolbachia pipientis
    M Kurz, I Iturbe-Ormaetxe, R Jarrott - & redox signaling, 2009 - online.liebertpub.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch