.
The Open Protein Structure Annotation Network
PDB Keyword
.

2igt

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the SAM Dependent Methyltransferase from Agrobacterium tumefaciens. To be Published
    Site MCSG
    PDB Id 2igt Target Id APC6201
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS5031,NP_531046.1, 176299 Molecular Weight 34436.57 Da.
    Residues 309 Isoelectric Point 5.68
    Sequence mqrtgelpaehvpvilessgagdfhlidsgnglkleqygdyrvvrpeaqalwrplvpdrvwqnadaift gdtdedgmgrwrfpkealgetwplsllgveflgrftafrhvgvfpeqivhwewlknavetadrplkvln lfgytgvaslvaaaagaevthvdaskkaigwakenqvlagleqapirwicedamkfiqreerrgstydi iltdppkfgrgthgevwqlfdhlplmldicreilspkalglvltaysirasfysmhelmretmrgaggv vasgelvireagldgktpgrvlstslfsrwepk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.89 Rfree 0.19236
    Matthews' coefficent 2.79 Rfactor 0.16231
    Waters 940 Solvent Content 55.84

    Ligand Information
    Ligands SAM (S-ADENOSYLMETHIONINE) x 3;GOL (GLYCEROL) x 2;ACY (ACETIC) x 6;FMT (FORMIC) x 7
    Metals

    Jmol

     
    Google Scholar output for 2igt
    1. YccW is the m5C methyltransferase specific for 23S rRNA nucleotide 1962
    E Purta, M O'Connor, JM Bujnicki - Journal of molecular , 2008 - Elsevier
     
    2. Crystal structure of the Escherichia coli 23S rRNA: m5C methyltransferase RlmI (YccW) reveals evolutionary links between RNA modification enzymes
    S Sunita, KL Tkaczuk, E Purta, JM Kasprzak - Journal of molecular , 2008 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch