.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ia2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a putative transcriptional regulator RHA06195 from Rhodococcus sp. RHA1. To be Published
    Site MCSG
    PDB Id 2ia2 Target Id APC6052
    Molecular Characteristics
    Source Rhodococcus sp. rha1
    Alias Ids TPS4993,RHA06195, 101510 Molecular Weight 28848.32 Da.
    Residues 265 Isoelectric Point 5.60
    Sequence mtateptekilpspdyvqslarglavircfdhrnqrrtlsdvaratdltratarrflltlvelgyvatd gsafwltprvlelgysylsslslpevaqphleklshkvhesssvsildgadivyvarvpvsrimtvgit igtrlpayatsmgrvllaglpddeldaylekldiqrltertitardelkaailavradgicvldqelea glrsmaapirgasgltvaavnistpaarysledlhsdlipslrvtatdieqdlatvnr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.10 Rfree 0.22326
    Matthews' coefficent 2.77 Rfactor 0.18569
    Waters 741 Solvent Content 55.61

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ia2
    1. Domain definition and target classification for CASP7
    ND Clarke, I Ezkurdia, J Kopp, RJ Read - Proteins: Structure, , 2007 - Wiley Online Library
     
    2. The evolutionary history of archaeal MCM helicases: a case study of vertical evolution combined with hitchhiking of mobile genetic elements
    M Krupovi_, S Gribaldo, DH Bamford - Molecular biology and , 2010 - SMBE
     
    3. Reconstruction of Protein Backbone with the alpha-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - Journal of Information Science , 2010 - etd.lib.nsysu.edu.tw
     
    4. A simplified homology_model builder toward highly protein_like structures: An inspection of restraining potentials
    TR Kim, S Oh, JSW Yang, S Lee - Journal of , 2012 - Wiley Online Library
     
    5. Reconstruction of Protein Backbone with the a-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - 2007 - asiair.asia.edu.tw
     
    6. Refinement of All-atom Backbone Prediction of Proteins
    HY Chang - 2008 - etd.lib.nsysu.edu.tw
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch