.
The Open Protein Structure Annotation Network
PDB Keyword
.

2i7g

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of Monooxygenase from Agrobacterium tumefaciens. To be Published 2006
    Site MCSG
    PDB Id 2i7g Target Id APC7248
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS5099,NP_532980.1, 176299 Molecular Weight 38670.98 Da.
    Residues 353 Isoelectric Point 5.96
    Sequence melglytfadvnpnpadgrgpegarrlrelleeieladqvgldvfglgehhrpdyvvsspstvlaaaav ktknirltsavsvlssddpvrvfqqfstvdllsngraeimagrgsfiesyplfgydledydvlfaekld lllalreqevvtwsgtkhpaingrgvyprplqerlpvwiavggtpqsvaragamglpvalaiiggeyrr faplfdlyheaarragqektklrtsinvhgfiadttdkaadqfygpqaevmnrigrergwgptnrahfd aargpegnlflgepelvaekiikahgvfkndrfllqmaiglmphdqimrgielygtkvaplvrkeltgs adpvkata
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.73 Rfree 0.20199
    Matthews' coefficent 2.26 Rfactor 0.1696
    Waters 660 Solvent Content 45.51

    Ligand Information
    Ligands SO4 (SULFATE) x 3;PEG (DI(HYDROXYETHYL)ETHER) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch