.
The Open Protein Structure Annotation Network
PDB Keyword
.

2i10

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of putative TetR transcriptional regulator from Rhodococcus sp. RHA1. To be Published
    Site MCSG
    PDB Id 2i10 Target Id APC5890
    Molecular Characteristics
    Source Rhodococcus sp. rha1
    Alias Ids TPS4904,RHA09783, 101510 Molecular Weight 21522.37 Da.
    Residues 198 Isoelectric Point 5.02
    Sequence mpggrrrgfddqvalqtamelfwrqgyegtsitdltkalginppslyaafgskrdlfektldrymcert lqleeamvrptaheavldfltgrvevftapgqpfgcmtvqaglasgephheivdlltaareqmrqtvld rfekaladgdlpagtdctalaryvmaavyglsveaasgapreeltaaailaaqvvpraqm
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.05 Rfree 0.2452
    Matthews' coefficent 2.40 Rfactor 0.2024
    Waters 138 Solvent Content 48.85

    Ligand Information
    Ligands NPO (P-NITROPHENOL) x 1;PGE (TRIETHYLENE) x 1
    Metals

    Jmol

     
    Google Scholar output for 2i10
    1. The copper-inducible ComR (YcfQ) repressor regulates expression of ComC (YcfR), which affects copper permeability of the outer membrane of Escherichia coli
    M Mermod, D Magnani, M Solioz, JV Stoyanov - BioMetals, 2012 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch