.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hyj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a tetR-family transcriptional regulator from Streptomyces coelicolor. To be Published 2006
    Site MCSG
    PDB Id 2hyj Target Id APC6243
    Molecular Characteristics
    Source Streptomyces coelicolor a3
    Alias Ids TPS5051,NP_733652.1, 100226 Molecular Weight 21735.41 Da.
    Residues 200 Isoelectric Point 5.88
    Sequence msprrsaaeaqatrgrilgraaeiaseegldgitigrlaeelemsksgvhkhfgtketlqistldkafv dfwhrvvepalaeppglrrlravcansvgyleepllpggclltaalseydgrpgrvrdavaevwsrwre qlradltaavdkgelpagfdveqalfeivaaglalnaamqlqhdrtaadrarraieralaqs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.19 Rfree 0.2469
    Matthews' coefficent 2.79 Rfactor 0.1913
    Waters 127 Solvent Content 55.93

    Ligand Information
    Ligands SO4 (SULFATE) x 1
    Metals CA (CALCIUM) x 1

    Jmol

     
    Google Scholar output for 2hyj
    1. Crystal structure of the Vibrio cholerae quorum-sensing regulatory protein HapR
    RS De Silva, G Kovacikova, W Lin, RK Taylor - Journal of , 2007 - Am Soc Microbiol
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch