.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hxo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the transcriptional regulator SCO7222, a TetR from Streptomyces coelicolor. To be Published
    Site MCSG
    PDB Id 2hxo Target Id APC6012
    Molecular Characteristics
    Source Streptomyces coelicolor a3
    Alias Ids TPS4977,NP_631278, 100226 Molecular Weight 25024.64 Da.
    Residues 236 Isoelectric Point 5.51
    Sequence masrsrrperrqeplsrerivgaavelldtvgergltfralaerlatgpgaiywhitgkaellgaatda vvtaavtagptgaadspqdavravalglwdateahpwlatqlatqlsrtpwgtvaprifeslgrqvqam gvpeahwftassalmhyilgaagqnaansasagpvgadvdrdefldtvstawegldpdaypftravadq vrghddreqflagitlvltgitalhrpgr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.40 Rfree 0.26
    Matthews' coefficent 2.63 Rfactor 0.226
    Waters 83 Solvent Content 53.30

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2hxo
    1. A comprehensive analysis of structural and sequence conservation in the TetR family transcriptional regulators
    Z Yu, SE Reichheld, A Savchenko, J Parkinson - Journal of molecular , 2010 - Elsevier
     
    2. New insights into the structure, function and evolution of TETR family transcriptional regulators
    Z Yu - 2010 - 142.150.190.46
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch