.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hxi

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a putative transcriptional regulator TetR from Streptomyces coelicolor A3(2). To be Published
    Site MCSG
    PDB Id 2hxi Target Id APC6293
    Molecular Characteristics
    Source Streptomyces coelicolor a3
    Alias Ids TPS5066,NP_630678.1, 100226 Molecular Weight 23648.48 Da.
    Residues 217 Isoelectric Point 6.18
    Sequence magrrrwsteqildaaaelllagdaetfsvrklaaslgtdssslyrhfrnktellravadrillsamdg yrpegdwkqrltavalrlresfgqqpqlaavwgrhgsggtgsrlmmeevlqalrasglpddeiparyhr lvilisslitaeggfgavgaqeheqgmeqfrvavlgadperfpalshfareirplgadrgaafeeilaa hlahleaaap
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.23187
    Matthews' coefficent 2.04 Rfactor 0.18734
    Waters 442 Solvent Content 39.81

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2hxi
    1. Structures of the TetR-like simocyclinone efflux pump repressor, SimR, and the mechanism of ligand-mediated derepression
    TBK Le, CEM Stevenson, HP Fiedler, A Maxwell - Journal of molecular , 2011 - Elsevier
     
    2. Crystallization and preliminary X-ray analysis of the TetR-like efflux pump regulator SimR
    TBK Le, CEM Stevenson, MJ Buttner - Section F: Structural , 2011 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch