.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hwj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of protein Atu1540 from Agrobacterium tumefaciens. To be Published
    Site MCSG
    PDB Id 2hwj Target Id APC5835
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS4868,NP_532229.1, 176299 Molecular Weight 23536.58 Da.
    Residues 205 Isoelectric Point 6.56
    Sequence mthiyeprlsriaidklrptqiavgfrevelkrkewretrkkdgddflgnhivpvvagpkdraylidhh hlvlalskegvehvltsevakfshlgkdefwsvmdhrnliypfdaqglrrqsgdipknihdleddpfrs lagalrmaggyakviipfsefgwadflrrridrdllsdsfddalaeamklaksrearhlpgwcgvee
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.61 Rfree 0.27261
    Matthews' coefficent 2.86 Rfactor 0.1981
    Waters 95 Solvent Content 56.95

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2hwj
    1. Domain definition and target classification for CASP7
    ND Clarke, I Ezkurdia, J Kopp, RJ Read - Proteins: Structure, , 2007 - Wiley Online Library
     
    2. The Fragment-based Consistency Score in Model Quality Assessment for De Novo Prediction of Protein Structures
    H Cetin, TN Sasaki, M Sasai - Chem-Bio Informatics Journal, 2011 - J-STAGE
     
    3. ___________________________________
    H Cetin_ _____ ____ - CBI _____, 2011 - J-STAGE
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch