.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hrz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the nucleoside-diphosphate-sugar epimerase from Agrobacterium tumefaciens. To be Published
    Site MCSG
    PDB Id 2hrz Target Id APC6150
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS5020,NP_533403.1, 176299 Molecular Weight 35532.88 Da.
    Residues 328 Isoelectric Point 6.21
    Sequence mhiaiigaagmvgrkltqrlvkdgslggkpvekftlidvfqpeapagfsgavdaraadlsapgeaeklv earpdvifhlaaivsgeaeldfdkgyrinldgtrylfdairiangkdgykprvvftssiavfgaplpyp ipdefhttpltsygtqkaicelllsdysrrgffdgigirlpticirpgkpnaaasgffsnilreplvgq eavlpvpesirhwhasprsavgflihgamidvekvgprrnlsmpglsatvgeqiealrkvagekavali rrepnemimrmcegwapgfeakrarelgftaessfeeiiqvhiedelggslk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.85 Rfree 0.22457
    Matthews' coefficent 2.58 Rfactor 0.18455
    Waters 316 Solvent Content 52.37

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch