.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hr3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative transcriptional regulator protein from Pseudomonas aeruginosa PA01 at 2.4 A resolution. To be Published
    Site MCSG
    PDB Id 2hr3 Target Id APC5815
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS4852,AAG06455.1, 208964 Molecular Weight 16373.69 Da.
    Residues 147 Isoelectric Point 9.94
    Sequence mptnqdlqlaahlrsqvttltrrlrreaqadpvqfsqlvvlgaidrlggdvtpselaaaermrssnlaa llrelergglivrhadpqdgrrtrvslssegrrnlygnrakreewlvramhacldeserallaaagpll trlaqfeep
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.40 Rfree 0.28021
    Matthews' coefficent 2.30 Rfactor 0.20813
    Waters 58 Solvent Content 45.50

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2hr3
    1. Crystal structure of the MarR family regulatory protein, ST1710, from Sulfolobus tokodaii strain 7
    T Kumarevel, T Tanaka, M Nishio, SCB Gopinath - Journal of structural , 2008 - Elsevier
     
    2. Domain definition and target classification for CASP7
    ND Clarke, I Ezkurdia, J Kopp, RJ Read - Proteins: Structure, , 2007 - Wiley Online Library
     
    3. Protein structural classification and family identification by multifractal analysis and wavelet spectrum
    SM Zhu, ZG Yu, A Vo - Chinese Physics B, 2011 - iopscience.iop.org
     
    4. Solution structure of the human HSPC280 protein
    J Lin, T Zhou, J Wang - Protein Science, 2011 - Wiley Online Library
     
    5. Structure and Function of the Cardiac Stress Response Protein MS1
    CLF Fogl - 2011 - lra.le.ac.uk
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch