.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hmc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of Dihydrodipicolinate Synthase DapA from Agrobacterium tumefaciens. To be Published 2006
    Site MCSG
    PDB Id 2hmc Target Id APC6154
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS5023,AAL45469, 176299 Molecular Weight 34506.81 Da.
    Residues 321 Isoelectric Point 6.18
    Sequence mtasifsgvipalmtpcrqdrtpdfdalvrkgkeliadgmsavvycgsmgdwplltdeqrmegverlvk agipvivgtgavntasavahavhaqkvgakglmviprvlsrgsviaaqkahfkailsaapeipaviyns pyygfatradlffalraehknlvgfkefggpadmryaaenitsrddevtlmigvdtavvhgfvncgatg aitgignvlpkevihlcklsqaaakgdadararaleleqalavlssfdegpdlvlyfkymmvlkgdkey tlhfnetdaltdsqrgyveaqfklfnswyadwsklpgavqtckaa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.24674
    Matthews' coefficent 2.37 Rfactor 0.18715
    Waters 409 Solvent Content 48.08

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 2

    Jmol

     
    Google Scholar output for 2hmc
    1. Crystal structure and kinetic study of dihydrodipicolinate synthase from Mycobacterium tuberculosis
    G Kefala, G Evans, M Griffin, S Devenish, F Pearce - Biochem. J, 2008 - biochemj.org
     
    2. Domain definition and target classification for CASP7
    ND Clarke, I Ezkurdia, J Kopp, RJ Read - Proteins: Structure, , 2007 - Wiley Online Library
     
    3. Characterization and crystal structure of lysine insensitive Corynebacterium glutamicum dihydrodipicolinate synthase (cDHDPS) protein
    EA Rice, GA Bannon, KC Glenn, SS Jeong - Archives of biochemistry , 2008 - Elsevier
     
    4. Conserved main_chain peptide distortions: A proposed role for Ile203 in catalysis by dihydrodipicolinate synthase
    RCJ Dobson, MDW Griffin, SRA Devenish - Protein , 2008 - Wiley Online Library
     
    5. Reconstruction of Protein Backbone with the alpha-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - Journal of Information Science , 2010 - etd.lib.nsysu.edu.tw
     
    6. Enzymology of bacterial lysine biosynthesis
    C Dogovski, SC Atkinson - InTech Open Access , 2012 - cdn.intechopen.com
     
    7. Cloning, expression, purification and crystallization of dihydrodipicolinate synthase from Agrobacterium tumefaciens
    SC Atkinson, C Dogovski, RCJ Dobson - Section F: Structural , 2012 - scripts.iucr.org
     
    8. Reconstruction of Protein Backbone with the a-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - 2007 - asiair.asia.edu.tw
     
    9. Toward better refinement of comparative models: predicting loops in inexact environments
    BD Sellers, K Zhu, S Zhao, RA Friesner - Proteins: Structure, , 2008 - Wiley Online Library
     
    10. Refinement of All-atom Backbone Prediction of Proteins
    HY Chang - 2008 - etd.lib.nsysu.edu.tw
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch