.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hku

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a transcriptional regulator from Rhodococcus sp. RHA1. To be Published
    Site MCSG
    PDB Id 2hku Target Id APC6040
    Molecular Characteristics
    Source Rhodococcus sp. rha1
    Alias Ids TPS4986,RHA05169, 101510 Molecular Weight 22756.52 Da.
    Residues 211 Isoelectric Point 5.50
    Sequence mvpqtgraaratresgrqtrdalftaatelflehgegvpitqicaaagahpnqvtyyygskerlfveva caavlragkraeddaataetvgdyteklvgsllgpgapsvelftsamlmtgrrselrdlitdtlrtlhs sgevalirtlmrtgwqlragidveskafwsaifglviqktatgesfgysleeavavifanlqipetvrn tsid
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.25912
    Matthews' coefficent 2.31 Rfactor 0.21073
    Waters 144 Solvent Content 46.79

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 7;PG4 (TETRAETHYLENE) x 1
    Metals

    Jmol

     
    Google Scholar output for 2hku
    1. A comprehensive analysis of structural and sequence conservation in the TetR family transcriptional regulators
    Z Yu, SE Reichheld, A Savchenko, J Parkinson - Journal of molecular , 2010 - Elsevier
     
    2. New insights into the structure, function and evolution of TETR family transcriptional regulators
    Z Yu - 2010 - 142.150.190.46
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch