.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hjs

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of a probable aspartate-semialdehyde dehydrogenase from Pseudomonas aeruginosa. To be published
    Site MCSG
    PDB Id 2hjs Target Id APC5631
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS4729,AAG06504.1, 208964 Molecular Weight 35347.30 Da.
    Residues 336 Isoelectric Point 4.77
    Sequence msqplnvavvgatgsvgealvgllderdfplhrlhllasaesagqrmgfaesslrvgdvdsfdfssvgl affaaaaevsrahaeraraagcsvidlsgalepsvappvmvsvnaerlasqaapfllsspcavaaelce vlapllatldcrqlnltaclsvsslgregvkelarqtaellnarpleprlfdrqiafnllaqvgavdae ghsaierrifaevqallgerigplnvtciqapvffgdslsvtlqcaepvdlaavtrvldatkgiewvge gdyptvvgdalgqdetyvgrvragqadpcqvnlwivsdnvrkgaalnavllgellikhyl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.20888
    Matthews' coefficent 3.70 Rfactor 0.17748
    Waters 305 Solvent Content 66.79

    Ligand Information
    Ligands DIO (1,4-DIETHYLENE) x 10
    Metals

    Jmol

     
    Google Scholar output for 2hjs
    1. Domain definition and target classification for CASP7
    ND Clarke, I Ezkurdia, J Kopp, RJ Read - Proteins: Structure, , 2007 - Wiley Online Library
     
    2. Purification, crystallization and preliminary X-ray diffraction analysis of aspartate semialdehyde dehydrogenase (Rv3708c) from Mycobacterium tuberculosis
    R Vyas, V Kumar, S Panjikar, S Karthikeyan - Section F: Structural , 2008 - scripts.iucr.org
     
    3. Crystal Structure of N-acetyl-_-glutamyl-phosphate Reductase from Mycobacterium tuberculosis in Complex with NADP+
    LT Cherney, MM Cherney, CR Garen, C Niu - Journal of molecular , 2007 - Elsevier
     
    4. Reconstruction of Protein Backbone with the alpha-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - Journal of Information Science , 2010 - etd.lib.nsysu.edu.tw
     
    5. Reconstruction of Protein Backbone with the a-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - 2007 - asiair.asia.edu.tw
     
    6. Refinement of All-atom Backbone Prediction of Proteins
    HY Chang - 2008 - etd.lib.nsysu.edu.tw
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch