.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gyq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of YcfI protein, a putative structural protein from Rhodopseudomonas palustris. To be Published
    Site MCSG
    PDB Id 2gyq Target Id APC6105
    Molecular Characteristics
    Source Rhodopseudomonas palustris cga009
    Alias Ids TPS5008,NP_948647.1, 258594 Molecular Weight 18794.28 Da.
    Residues 169 Isoelectric Point 5.26
    Sequence mgffsrdiqtmedlllhglrdiyyaeqqitkalpkmieqatnrdlsqgltshleetqkqierldqvfkk lgqkpsgvncpaidglikeadetageiadktvldaaivanaqavehyeiarygtliawaeelghddivr flttnlneekaantklntvalrkgvnrkaas
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.40 Rfree 0.1757
    Matthews' coefficent 2.29 Rfactor 0.1398
    Waters 394 Solvent Content 46.30

    Ligand Information
    Ligands ACT (ACETATE) x 4;EDO (1,2-ETHANEDIOL) x 2
    Metals FE (FE) x 5;ZN (ZINC) x 6;NA (SODIUM) x 1

    Jmol

     
    Google Scholar output for 2gyq
    1. The Ferritin-like superfamily: Evolution of the biological iron storeman from a rubrerythrin-like ancestor
    SC Andrews - Biochimica et Biophysica Acta (BBA)-General Subjects, 2010 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch