.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gu3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of YpmB protein from Bacillus subtilis. To be Published
    Site MCSG
    PDB Id 2gu3 Target Id APC1927
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS4574,GI2634656.1, 1423 Molecular Weight 17894.87 Da.
    Residues 161 Isoelectric Point 8.84
    Sequence mrkkaliftvifgiiflavllvsasiyksamaqkeegheaaaaeakketdlahvdqvetfvgkekyyvv kgtdkkgtalyvwvpadkkakilskeakegisedkaakiikdeglvskqkevhlaregnvllwevtyld kegqyslsyvdfttgkilknitp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.74 Rfree 0.2144
    Matthews' coefficent 2.02 Rfactor 0.188
    Waters 145 Solvent Content 39.19

    Ligand Information
    Ligands
    Metals NI (NICKEL) x 1

    Jmol

     
    Google Scholar output for 2gu3
    1. The structure of BVU2987 from Bacteroides vulgatus reveals a superfamily of bacterial periplasmic proteins with possible inhibitory function
    D Das, RD Finn, D Carlton, MD Miller - Section F: Structural , 2010 - scripts.iucr.org
     
    2. A Protein Export Pathway Involving Escherichia coli Porins
    G Prehna, G Zhang, X Gong, M Duszyk, M Okon - Structure, 2012 - Elsevier
     
    3. Dimensionality reduction in computational demarcation of protein tertiary structures
    RR Joshi, PR Panigrahi, RN Patil - Journal of Molecular Modeling, 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch