.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gfn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of HTH-type transcriptional regulator pksA related protein from Rhodococcus sp. RHA1. To be Published
    Site MCSG
    PDB Id 2gfn Target Id APC6003
    Molecular Characteristics
    Source Rhodococcus sp. rha1
    Alias Ids TPS4973,RHA05868, 101510 Molecular Weight 22476.18 Da.
    Residues 209 Isoelectric Point 5.23
    Sequence vpkivdhderrraladavlaliaregisavttravaeesgwstgvlnhyfgsrhelllaalrragdiqg dryrtildeegagpieklrnitasilplderrlamtrvflffyaegaaeetargeiaaflarwrgvvre svvaaqregtvstdldadavtvalvaltdglalqaildpvvmkaisaedaaarcvdaavrrtteeagavgr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.21482
    Matthews' coefficent 1.97 Rfactor 0.17306
    Waters 272 Solvent Content 37.60

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 1

    Jmol

     
    Google Scholar output for 2gfn
    1. Crystal structure of the Vibrio cholerae quorum-sensing regulatory protein HapR
    RS De Silva, G Kovacikova, W Lin, RK Taylor - Journal of , 2007 - Am Soc Microbiol
     
    2. A comprehensive analysis of structural and sequence conservation in the TetR family transcriptional regulators
    Z Yu, SE Reichheld, A Savchenko, J Parkinson - Journal of molecular , 2010 - Elsevier
     
    3. Crystal structure of TM1030 from Thermotoga maritima at 2.3 resolution reveals molecular details of its transcription repressor function
    L Premkumar, CL Rife, S Sri Krishna - Proteins: Structure, , 2007 - Wiley Online Library
     
    4. New insights into the structure, function and evolution of TETR family transcriptional regulators
    Z Yu - 2010 - 142.150.190.46
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch