The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a probable transcriptional regulator from Pseudomonas aeruginosa PAO1. To be Published
    Site MCSG
    PDB Id 2gen Target Id APC6095
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS5004,NP_250527.1, 208964 Molecular Weight 15246.45 Da.
    Residues 138 Isoelectric Point 6.47
    Sequence lylagigqyaalleagfararsaeetvrllvtsyidwvvanpdwarfilhsrgrveagelgerlradnq ahfarihaalagyraeglfrempddcfasvvigpahdlarqwlagrtrvaladcrellaqvawdsvraa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.24842
    Matthews' coefficent 2.73 Rfactor 0.20967
    Waters 175 Solvent Content 54.88

    Ligand Information


    Google Scholar output for 2gen
    1. A comprehensive analysis of structural and sequence conservation in the TetR family transcriptional regulators
    Z Yu, SE Reichheld, A Savchenko, J Parkinson - Journal of molecular , 2010 - Elsevier
    2. Crystal structure of TM1030 from Thermotoga maritima at 2.3 resolution reveals molecular details of its transcription repressor function
    L Premkumar, CL Rife, S Sri Krishna - Proteins: Structure, , 2007 - Wiley Online Library
    3. New insights into the structure, function and evolution of TETR family transcriptional regulators
    Z Yu - 2010 -
    4. EM-Fold: De Novo Atomic-Detail Protein Structure Determination from Medium-Resolution Density Maps
    S Lindert, N Alexander, N Wtzel, M Karaka_ - Structure, 2012 - Elsevier
    S Lindert - 2011 - etd.library.vanderbilt.edu

    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch