.
The Open Protein Structure Annotation Network
PDB Keyword
.

2g3b

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative TetR-family transcriptional regulator from Rhodococcus sp. To be Published
    Site MCSG
    PDB Id 2g3b Target Id APC6001
    Molecular Characteristics
    Source Rhodococcus sp. rha1
    Alias Ids TPS4971,RHA04765, 101510 Molecular Weight 22725.14 Da.
    Residues 208 Isoelectric Point 5.20
    Sequence mserrdailkasataiaqrgirglrvndvaevagvspgllyyhfkdriglleaalnyindrarayrseg egsgdsardrltrsllgeiqdrpevvenslawnelrasavyeealrdplarttaawvseiadaivqaqa tgeisrsldpqptavtmtalveglsgrwlckeistedarshllgaidvvmsepthhtadtpvtptpkeyr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.24
    Matthews' coefficent 2.22 Rfactor 0.185
    Waters 227 Solvent Content 44.61

    Ligand Information
    Ligands GOL (GLYCEROL) x 4
    Metals

    Jmol

     
    Google Scholar output for 2g3b
    1. HKL-3000: the integration of data reduction and structure solution-from diffraction images to an initial model in minutes
    W Minor, M Cymborowski, Z Otwinowski - Section D: Biological , 2006 - scripts.iucr.org
     
    2. Crystal structure of the Vibrio cholerae quorum-sensing regulatory protein HapR
    RS De Silva, G Kovacikova, W Lin, RK Taylor - Journal of , 2007 - Am Soc Microbiol
     
    3. A comprehensive analysis of structural and sequence conservation in the TetR family transcriptional regulators
    Z Yu, SE Reichheld, A Savchenko, J Parkinson - Journal of molecular , 2010 - Elsevier
     
    4. Crystal Structure of Bacillus cereus HlyIIR, a Transcriptional Regulator of the Gene for Pore-forming Toxin Hemolysin II
    OV Kovalevskiy, AA Lebedev, AK Surin - Journal of molecular , 2007 - Elsevier
     
    5. New insights into the structure, function and evolution of TETR family transcriptional regulators
    Z Yu - 2010 - 142.150.190.46
     
    6. Molecular Dynamic Simulation Insights into the Normal State and Restoration of p53 Function
    T Fu, H Min, Y Xu, J Chen, G Li - International Journal of Molecular , 2012 - mdpi.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch