.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fxa

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the Protease Production Regulatory Protein hpr from Bacillus subtilis. TO BE PUBLISHED
    Site MCSG
    PDB Id 2fxa Target Id APC1181
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS4512,P11065, 1423 Molecular Weight 23711.78 Da.
    Residues 203 Isoelectric Point 5.34
    Sequence mnrveppydvkealvftqkmaqlskalwksiekdwqqwlkpydlninehhilwiayqlngasiseiakf gvmhvstafnfskkleergylrfskrlndkrntyvqlteegtevfwslleefdptrnavfkgsqplyhl fgkfpevaemmcmirhiygddfmeifetsltnidndfesvngklkkkakdsaadepaeelepvns
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.40 Rfree 0.23392
    Matthews' coefficent 2.76 Rfactor 0.2081
    Waters 177 Solvent Content 55.47

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 14;1PE (PENTAETHYLENE) x 2;P6G (HEXAETHYLENE) x 1;PGE (TRIETHYLENE) x 1
    Metals

    Jmol

     
    Google Scholar output for 2fxa
    1. Crystal structure of the MarR family regulatory protein, ST1710, from Sulfolobus tokodaii strain 7
    T Kumarevel, T Tanaka, M Nishio, SCB Gopinath - Journal of structural , 2008 - Elsevier
     
    2. Structure of the N-terminal oligomerization domain of DnaD reveals a unique tetramerization motif and provides insights into scaffold formation
    S Schneider, W Zhang, P Soultanas, M Paoli - Journal of molecular biology, 2008 - Elsevier
     
    3. Protein structural classification and family identification by multifractal analysis and wavelet spectrum
    SM Zhu, ZG Yu, A Vo - Chinese Physics B, 2011 - iopscience.iop.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch