.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fsr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Acetyltranferase from Agrobacterium tumefaciens str. C58. To be Published
    Site MCSG
    PDB Id 2fsr Target Id APC5964
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS4959,NP_533107.1, 176299 Molecular Weight 18909.37 Da.
    Residues 171 Isoelectric Point 5.58
    Sequence mnhsiptlrterltlrplamadfpayrdfmasprstgvggpydlpstwgvfchdlanwhffghgalmid lgetgecigqiginhgplfpekelgwllyeghegrgyaaeaavalrdwafetlnlptlvsyvspqnrks aavaeriggtldplaprsdpedlvyryhqvkta
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.52 Rfree 0.19935
    Matthews' coefficent 2.30 Rfactor 0.17942
    Waters 216 Solvent Content 46.44

    Ligand Information
    Ligands FMT (FORMIC) x 1;PEG (DI(HYDROXYETHYL)ETHER) x 1
    Metals

    Jmol

     
    Google Scholar output for 2fsr
    1. The effects of dietary protein and age on albumin and the skeletal muscle transcript profile
    AE Thalacker-Mercer - 2007 - books.google.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch