| Title | Methyltransferase that modifies guanine 966 of the 16 S rRNA: functional identification and tertiary structure. J.Biol.Chem. 282 5880-5887 2007 | | Site | MCSG | | PDB Id | | Target Id | APC076 | | Molecular Characteristics | | Source | Escherichia coli | | Alias Ids | TPS4439,AAC76490, 562 | Molecular Weight | 21676.42 Da. | | Residues | 198 | Isoelectric Point | 5.96 | | Sequence | mkkpnhsgsgqiriiggqwrgrklpvpdspglrpttdrvretlfnwlapvivdaqcldcfagsgalgle alsryaagatliemdravsqqliknlatlkagnarvvnsnamsflaqkgtphnivfvdppfrrglleet inlledngwladealiyvesevenglptvpanwslhrekvagqvayrlyqreaqgesdad | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 2.05 | Rfree | 0.2169 | | Matthews' coefficent | 2.49 | Rfactor | 0.1833 | | Waters | 390 | Solvent Content | 50.53 |
| Ligand Information | | Ligands | EDO (1,2-ETHANEDIOL) x 1 | | Metals | CL (CHLORIDE) x 6 | | |
