The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the ywmB protein from Bacillus subtilis. To be Published
    Site MCSG
    PDB Id 2fpn Target Id APC1972
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS4578,GI2636202.1, 1423 Molecular Weight 28625.48 Da.
    Residues 246 Isoelectric Point 6.76
    Sequence mkkkqvshaiiisvmlsfviavfhtihaseltplaqmaegmerqdvsidkwtlhakqnlsltekefyqk vqrlkqeyrqydwviaredkmikaigtytdkknrtsfrlqlvttlkkhnptsyllyeqmsletpdswnd tyeqferetlgifqekvviftclnghlddnmnivlqkkanqllnefqarsvehvvepnfvsisaftdew eeyimtskhkmnlqialrsagmggkhtvtvgtpivttey
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.49 Rfree 0.28134
    Matthews' coefficent 3.55 Rfactor 0.24242
    Waters 53 Solvent Content 65.33

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch