.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fkb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative enzyme (possible Nudix hydrolase) from Escherichia Coli K12. To be Published
    Site MCSG
    PDB Id 2fkb Target Id APC5697
    Molecular Characteristics
    Source Escherichia coli k12
    Alias Ids TPS4768,AAC75359.1, 83333 Molecular Weight 20374.81 Da.
    Residues 180 Isoelectric Point 4.70
    Sequence meqrrlastewvdivneeneviaqasreqmraqclrhratyivvhdgmgkilvqrrtetkdflpgmlda taggvvqadeqllesarreaeeelgiagvpfaehgqfyfedkncrvwgalfscvshgpfalqedevsev cwltpeeitarcdeftpdslkalalwmkrnakneavetetae
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.00 Rfree 0.23053
    Matthews' coefficent 3.56 Rfactor 0.19908
    Waters 328 Solvent Content 65.41

    Ligand Information
    Ligands SO4 (SULFATE) x 6;GOL (GLYCEROL) x 9;ACT (ACETATE) x 4
    Metals MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 2fkb
    1. Functional and Structural Characterization of DR_0079 from Deinococcus radiodurans, a Novel Nudix Hydrolase with a Preference for Cytosine (Deoxy)
    GW Buchko, O Litvinova, H Robinson, AF Yakunin - Biochemistry, 2008 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch