.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fiu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Conserved Hypothetical Protein Atu0297 from Agrobacterium tumefaciens. To be Published
    Site MCSG
    PDB Id 2fiu Target Id APC5774
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS4820,NP_531003.1, 176299 Molecular Weight 10605.38 Da.
    Residues 95 Isoelectric Point 5.09
    Sequence makgywiaqvdvrdserykdyvstakpaferfganflarggsvtelegtararnvviefpsvqhaidcy nspeyqaaakirqevadaemmivegi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.2644
    Matthews' coefficent 1.95 Rfactor 0.19652
    Waters 149 Solvent Content 36.80

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2fiu
    1. Protein structural classification and family identification by multifractal analysis and wavelet spectrum
    SM Zhu, ZG Yu, A Vo - Chinese Physics B, 2011 - iopscience.iop.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch