.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fex

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of DJ-1 Superfamily Protein Atu0886 from Agrobacterium tumefaciens. To be Published
    Site MCSG
    PDB Id 2fex Target Id APC5900
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS4912,NP_531584.1, 176299 Molecular Weight 19450.82 Da.
    Residues 188 Isoelectric Point 4.99
    Sequence mtriaialaqdfadwepallaaaarsylgveivhatpdgmpvtsmgglkvtpdtsydaldpvdidalvi pgglswekgtaadlgglvkrfrdrdrlvagicaaasalggtgvlndvahtgnalashkaypayrgeahy rdqpravsdggvvtaagsapvsfaveilkslglfgpeaeaelqifaaehr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.70 Rfree 0.199
    Matthews' coefficent 2.78 Rfactor 0.164
    Waters 681 Solvent Content 55.68

    Ligand Information
    Ligands SO4 (SULFATE) x 2;GOL (GLYCEROL) x 1
    Metals

    Jmol

     
    Google Scholar output for 2fex
    1. Dissection of the dimerization modes in the DJ-1 superfamily
    HJ Jung, S Kim, YJ Kim, MK Kim, SG Kang, JH Lee - Molecules and , 2012 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch