.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fef

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of Protein PA2201 from Pseudomonas aeruginosa. To be Published
    Site MCSG
    PDB Id 2fef Target Id APC5629
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS4728,AAG05589.1, 208964 Molecular Weight 32848.15 Da.
    Residues 294 Isoelectric Point 5.14
    Sequence mhafpltldnrlaealplwrnlartdraprrnidladwkadwreliaaldrfsrshgyrqpfaaqghaa lenawawgqaaenastlllkaidrglagaelrsiyletaalwldysrllgaardslreqgevdfetapa laprtgqypfalqllamgvlldaqelipalveevlqfdtdrlldylgaaalgltsaseetfhprpfgql raffeeadgsdaqalapylqsqyreffqlspkaqkktrrltgpyawgwwamevsalgvlygwddgvlra sphylgdlvdyarargda
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.90 Rfree 0.22201
    Matthews' coefficent 2.56 Rfactor 0.1856
    Waters 476 Solvent Content 51.94

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 4
    Metals

    Jmol

     
    Google Scholar output for 2fef
    1. Recognition of Interaction Interface Residues in Low-Resolution Structures of Protein Assemblies Solely from the Positions of C_ Atoms
    RA Gadkari, D Varughese, N Srinivasan - PloS one, 2009 - dx.plos.org
     
    2. Polymorphic toxin systems: comprehensive characterization of trafficking modes, processing, mechanisms of action, immunity and ecology using comparative
    D Zhang, RF de Souza, V Anantharaman, LM Iyer - Biology , 2012 - biology-direct.com
     
    3. Short-Lived _-Helical Intermediates in the Folding of _-Sheet Proteins
    E Chen, ML Everett, ZE Holzknecht, RA Holzknecht - Biochemistry, 2010 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch