.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fbq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of transcriptional regulator PA3006. To be Published
    Site MCSG
    PDB Id 2fbq Target Id APC5893
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS4906,NP_251696.1, 208964 Molecular Weight 25782.59 Da.
    Residues 233 Isoelectric Point 9.38
    Sequence maqsetverildaaeqlfaekgfaetslrlitskagvnlaavnyhfgskkaliqavfsrflgpfcasle keldrrqakpeaqhatledllhllvsqamavkprsgndlsifmrllglafsqsqghlrkyleevygkvf rrymllvneaapklppielfwrvhfmlgaaafsmsgikalramaetdfgvntsteqvmhlmvpffaagm raesgiddpllagaqlrprnktpaka
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.23013
    Matthews' coefficent 2.49 Rfactor 0.18287
    Waters 242 Solvent Content 50.65

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2fbq
    1. A comprehensive analysis of structural and sequence conservation in the TetR family transcriptional regulators
    Z Yu, SE Reichheld, A Savchenko, J Parkinson - Journal of molecular , 2010 - Elsevier
     
    2. Crystal structure of TM1030 from Thermotoga maritima at 2.3 resolution reveals molecular details of its transcription repressor function
    L Premkumar, CL Rife, S Sri Krishna - Proteins: Structure, , 2007 - Wiley Online Library
     
    3. New insights into the structure, function and evolution of TETR family transcriptional regulators
    Z Yu - 2010 - 142.150.190.46
     
    4. Modelling Protein Structure Using Discrete Backbone Torsion Angles
    P Smith - 2010 - unsworks.unsw.edu.au
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch