.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fbi

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of transcriptional regulator PA4135. To be Published
    Site MCSG
    PDB Id 2fbi Target Id APC5816
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS4853,AAG07522.1, 208964 Molecular Weight 16390.22 Da.
    Residues 140 Isoelectric Point 9.93
    Sequence mstprpsltltllqareaamsffrpslnqhglteqqwrvirilrqqgemesyqlanqacilrpsmtgvl arlerdgivrrwkapkdqrrvyvnltekgqqcfvsmsgdmeknyqriqerfgeeklaqllellnelkki kp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.27645
    Matthews' coefficent 2.86 Rfactor 0.22259
    Waters 94 Solvent Content 57.03

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2fbi
    1. Crystal structure of the MarR family regulatory protein, ST1710, from Sulfolobus tokodaii strain 7
    T Kumarevel, T Tanaka, M Nishio, SCB Gopinath - Journal of structural , 2008 - Elsevier
     
    2. Characterization of FarR as a highly specialized, growth phase-dependent transcriptional regulator in Neisseria meningitidis
    S Schielke, C Spatz, RF Schwarz, B Joseph - International Journal of , 2011 - Elsevier
     
    3. Protein structural classification and family identification by multifractal analysis and wavelet spectrum
    SM Zhu, ZG Yu, A Vo - Chinese Physics B, 2011 - iopscience.iop.org
     
    4. Structural insight into the mechanism of DNA-binding attenuation of the Neisserial adhesin repressor NadR by the small natural ligand 4-hydroxyphenylacetic acid
    S Brier, L Fagnocchi, D Donnarumma, M Scarselli - Biochemistry, 2012 - ACS Publications
     
    5. Functional and molecular characterization of FarRa transcriptional regulator of the MarR family in Neisseria meningitidis
    S Schielke - 2011 - opus.bibliothek.uni-wuerzburg.de
     
    6. Dimensionality reduction in computational demarcation of protein tertiary structures
    RR Joshi, PR Panigrahi, RN Patil - Journal of Molecular Modeling, 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch