.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fa8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Putative Selenoprotein W-related family Protein from Agrobacterium tumefaciens. To be Published 2006
    Site MCSG
    PDB Id 2fa8 Target Id APC5776
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS4821,NP_530934.1, 176299 Molecular Weight 11509.54 Da.
    Residues 101 Isoelectric Point 5.65
    Sequence mtetkpriairyctqcnwllragwmaqeilqtfasdigevslipstgglfeitvdgtiiwerkrdggfp gpkelkqrirdlidperdlghvdrtkhegldt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.24808
    Matthews' coefficent 1.84 Rfactor 0.19812
    Waters 198 Solvent Content 33.03

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2fa8
    1. SelT, SelW, SelH, and Rdx12: genomics and molecular insights into the functions of selenoproteins of a novel thioredoxin-like family
    A Dikiy, SV Novoselov, DE Fomenko, A Sengupta - Biochemistry, 2007 - ACS Publications
     
    2. A novel structural motif and structural trees for proteins containing it
    AM Kargatov, AV Efimov - Biochemistry (Moscow), 2010 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch