.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fa1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural characterization of GntR/HutC family signaling domain. Protein Sci. 15 1-6 2006
    Site MCSG
    PDB Id 2fa1 Target Id APC5558
    Molecular Characteristics
    Source Escherichia coli k12
    Alias Ids TPS4690,NP_418526, 83333 Molecular Weight 17661.02 Da.
    Residues 157 Isoelectric Point 7.22
    Sequence naqarfsqnlldqgshptsekllsvlrpasghvadalgitegenvihlrtlrrvngvalclidhyfadl tlwptlqrfdsgslhdflreqtgialrrsqtrisarraqakecqrleipnmspllcvrtlnhrdgessp aeysvsltradmieftmeh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.24121
    Matthews' coefficent 2.08 Rfactor 0.18688
    Waters 327 Solvent Content 40.86

    Ligand Information
    Ligands BDF (BETA-D-FRUCTOPYRANOSE) x 1
    Metals

    Jmol

     
    Google Scholar output for 2fa1
    1. PSI-2: structural genomics to cover protein domain family space
    BH Dessailly, R Nair, L Jaroszewski, JE Fajardo - Structure, 2009 - Elsevier
     
    2. Structural characterization of GntR/HutC family signaling domain
    M Gorelik, VV Lunin, T Skarina, A Savchenko - Protein science, 2006 - Wiley Online Library
     
    3. Insight into the induction mechanism of the GntR/HutC bacterial transcription regulator YvoA
    M Resch, E Schiltz, F Titgemeyer - Nucleic acids , 2010 - Oxford Univ Press
     
    4. The crystal structure of the effector_binding domain of the trehalose repressor TreR from Bacillus subtilis 168 reveals a unique quarternary assembly
    P _ez_ov, V Krej_i_kov, D Borek - Proteins: Structure, , 2007 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch