.
The Open Protein Structure Annotation Network
PDB Keyword
.

2f6s

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of cell filamentation protein (fic) from Helicobacter pylori. To be Published
    Site MCSG
    PDB Id 2f6s Target Id APC5819
    Molecular Characteristics
    Source Helicobacter pylori 26695
    Alias Ids TPS4856,NP_207950, 85962 Molecular Weight 20531.82 Da.
    Residues 177 Isoelectric Point 8.87
    Sequence mhldrqslekakhliqsglidtievgtikglqeihrflfeglyefagkirdkniakgnfrfanclyldl ilpriesmpqnnfnqivekyvemniahpflegngratriwldlllkkelkkivlwdridkaaylsamer spvndleiktllkkhlssntndpltlikgitqsyyyegl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.21452
    Matthews' coefficent 3.76 Rfactor 0.16867
    Waters 235 Solvent Content 67.31

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 2
    Metals ZN (ZINC) x 2

    Jmol

     
    Google Scholar output for 2f6s
    1. Fido, a novel AMPylation domain common to fic, doc, and AvrB
    LN Kinch, ML Yarbrough, K Orth, NV Grishin - PLoS One, 2009 - dx.plos.org
     
    2. Doc of prophage P1 is inhibited by its antitoxin partner Phd through fold complementation
    A Garcia-Pino, M Christensen-Dalsgaard - Journal of Biological , 2008 - ASBMB
     
    3. Kinetic and structural insights into the mechanism of AMPylation by VopS Fic domain
    P Luong, LN Kinch, CA Brautigam, NV Grishin - Journal of Biological , 2010 - ASBMB
     
    4. Structural basis of Fic-mediated adenylylation
    J Xiao, CA Worby, S Mattoo, B Sankaran - Nature structural & , 2010 - nature.com
     
    5. AMPylation: something old is new again
    AR Woolery, P Luong, CA Broberg - Frontiers in Microbiology, 2010 - ncbi.nlm.nih.gov
     
    6. Fic domain_catalyzed adenylylation: Insight provided by the structural analysis of the type IV secretion system effector BepA
    DV Palanivelu, A Goepfert, M Meury, P Guye - Protein , 2011 - Wiley Online Library
     
    7. Structural insights into the function of the core-circadian factor TIMING OF CAB2 EXPRESSION 1 (TOC1)
    E Kolmos, H Schoof, M Plmer - Journal of circadian , 2008 - biomedcentral.com
     
    8. Crystal structure of the Fic (Filamentation induced by cAMP) family protein SO4266 (gi| 24375750) from Shewanella oneidensis MR_1 at 1.6 resolution
    D Das, S Krishna, D McMullan - Proteins: Structure, , 2009 - Wiley Online Library
     
    9. Polymorphic toxin systems: comprehensive characterization of trafficking modes, processing, mechanisms of action, immunity and ecology using comparative
    D Zhang, RF de Souza, V Anantharaman, LM Iyer - Biology , 2012 - biology-direct.com
     
    10. Comparative analysis of Histophilus somni IbpA with other FIC enzymes reveals differences in substrate and nucleotide specificities
    S Mattoo, E Durrant, MJ Chen, J Xiao, CS Lazar - Journal of Biological , 2011 - ASBMB
     
    11. Comparative Analysis of Histophilus somni Immunoglobulin-binding Protein A (IbpA) with Other Fic Domain-containing Enzymes Reveals Differences in Substrate and
    S Mattoo, E Durrant, MJ Chen, J Xiao, CS Lazar - Journal of Biological , 2011 - ASBMB
     
    12. STRUCTURAL AND FUNCTIONAL STUDIES ON THE HELICOBACTER PYLORI PROTEOME: THE STATE OF THE ART
    G Zanotti, L Cendron - Functional Proteomics & Nanotechnology- , 2010 - books.google.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch