| Title | Structure of a GTP Pyrophosphokinase Family Protein from Streptococcus pneumoniae. To be Published | | Site | MCSG | | PDB Id | | Target Id | APC80416 | | Molecular Characteristics | | Source | Streptococcus pneumoniae tigr4 | | Alias Ids | TPS5600,AAK75209, 170187 | Molecular Weight | 26181.45 Da. | | Residues | 223 | Isoelectric Point | 5.71 | | Sequence | mtleweefldpyiqavgelkiklrgirkqyrkqnkhspiefvtgrvkpiesikekmarrgityatlehd lqdiaglrvmvqfvddvkevvdilhkrqdmriiqerdyithrkasgyrsyhvvveytvdtingaktila eiqirtlamnfwatiehslnykyqgdfpdeikkrleitariahqldeemgeirddiqeaqalfdplsrk lndgvgnsddtdeeyr | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 2.40 | Rfree | 0.23423 | | Matthews' coefficent | 2.55 | Rfactor | 0.18219 | | Waters | 251 | Solvent Content | 51.80 |
| Ligand Information | | Ligands | PG4 (TETRAETHYLENE) x 1;GOL (GLYCEROL) x 1 | | Metals | CL (CHLORIDE) x 1 | | |