.
The Open Protein Structure Annotation Network
PDB Keyword
.

2bas

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structures of YkuI and its complex with second messenger cyclic Di-GMP suggest catalytic mechanism of phosphodiester bond cleavage by EAL domains. J.Biol.Chem. 284 13174-13184 2009
    Site MCSG
    PDB Id 2bas Target Id APC1285
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS4526,O35014, 1423 Molecular Weight 47954.77 Da.
    Residues 407 Isoelectric Point 4.65
    Sequence mldpldiltniddvlpyyqaifsaeeqkvvgyevlgriladseiqslgpffldagipeeyklevdnrii rqaldrfleadsdllifmnqdanllmldhgesflellkeyeakgielhrfvleitehnfegdieqlyhm layyrtygikiavdnigkessnldriallspdllkidlqalkvsqpspsyehvlysisllarkigaall yedieanfqlqyawrnggryfqgyylvspsetflerdvlkqrlktefhqfithekkkletvyehseqfy krvhqavtslrknnlssdddfikklaeeltdcsfriymcdeegdqltgnvfkqdgewiyqpeyaeknws wrpyflenimrmrnlrkgffsdlysdletgemirtfsypmddqmylfidlpysylyeqdgli
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.61 Rfree 0.287
    Matthews' coefficent 2.38 Rfactor 0.20255
    Waters 255 Solvent Content 48.24

    Ligand Information
    Ligands BME (BETA-MERCAPTOETHANOL) x 1
    Metals

    Jmol

     
    Google Scholar output for 2bas
    1. Structure and mechanism of a bacterial light-regulated cyclic nucleotide phosphodiesterase
    TRM Barends, E Hartmann, JJ Griese, T Beitlich - Nature, 2009 - nature.com
     
    2. Catalytic mechanism of cyclic di-GMP-specific phosphodiesterase: a study of the EAL domain-containing RocR from Pseudomonas aeruginosa
    F Rao, Y Yang, Y Qi, ZX Liang - Journal of bacteriology, 2008 - Am Soc Microbiol
     
    3. Structural analysis of the GGDEF-EAL domain-containing c-di-GMP receptor FimX
    MVAS Navarro, N De, N Bae, Q Wang, H Sondermann - Structure, 2009 - Elsevier
     
    4. Crystal structures of YkuI and its complex with second messenger cyclic Di-GMP suggest catalytic mechanism of phosphodiester bond cleavage by EAL domains
    G Minasov, S Padavattan, L Shuvalova - Journal of Biological , 2009 - ASBMB
     
    5. Influence of a joining helix on the BLUF domain of the YcgF photoreceptor from Escherichia coli
    C Schroeder, K Werner, H Otten, S Krtzig - , 2008 - Wiley Online Library
     
    6. Structural insight into the mechanism of c-di-GMP hydrolysis by EAL domain phosphodiesterases
    A Tchigvintsev, X Xu, A Singer, C Chang - Journal of molecular , 2010 - Elsevier
     
    7. Understanding the cell in terms of structure and function: insights from structural genomics
    DJ Rigden - Current opinion in biotechnology, 2006 - Elsevier
     
    8. Biological Evaluation of Dilactone Lignan Analogues of Phellinsin A as Chitin Synthase II Inhibitors
    S Lee, JN Kim, E Kim, MS Kim, HK Lee - Notes, 2009 - journal.kcsnet.or.kr
     
    9. Sensing the messenger: The diverse ways that bacteria signal through c_di_GMP
    PV Krasteva, KM Giglio, H Sondermann - Protein Science, 2012 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch