.
The Open Protein Structure Annotation Network
PDB Keyword
.

2b0v

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray structure of NUDIX hydrolase from Nitrosomonas europaea. To be Published
    Site MCSG
    PDB Id 2b0v Target Id APC5831
    Molecular Characteristics
    Source Nitrosomonas europaea atcc 19718
    Alias Ids TPS4866,NP_840278, 228410 Molecular Weight 16944.39 Da.
    Residues 149 Isoelectric Point 5.32
    Sequence mtwkpnvtvaavieqddkyllveeiprgtaiklnqpaghlepgesiiqacsrevleetghsflpevltg iyhwtcasngttylrftfsgqvvsfdpdrkldtgivraawfsideirakqamhrtplvmqciedyhagk rypldilqyyd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.55 Rfree 0.2063
    Matthews' coefficent 2.00 Rfactor 0.1669
    Waters 164 Solvent Content 37.00

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 1
    Metals CL (CHLORIDE) x 1;NA (SODIUM) x 1

    Jmol

     
    Google Scholar output for 2b0v
    1. Encoding protein structure with functions on graphs
    P Bose, X Yu, RW Harrison - Bioinformatics and Biomedicine , 2011 - ieeexplore.ieee.org
     
    2. Crystallization and Preliminary Diffraction Studies of Nudix Hydrolase YmfB from Escherichia coli K-1
    MK Hong, JK Kim, YJ Ahn - Protein and Peptide , 2009 - ingentaconnect.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch