The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Hypothetical Protein NE0471 from Nitrosomonas europaea. To be Published
    Site MCSG
    PDB Id 2auw Target Id APC5860
    Molecular Characteristics
    Source Nitrosomonas europaea atcc 19718
    Alias Ids TPS4879,NP_840556, 228410 Molecular Weight 18830.42 Da.
    Residues 166 Isoelectric Point 5.59
    Sequence mneyffpkltavealapyrlrttwstgevlevdvgdilrkipdlapildpeafarvhiaewegsvewfd tefgrdnvyawakeqagevshemfgdwmhrnnlslttaaealgisrrmvsyyrtahkiiprtiwlaclg weatrpetktlprtlpaayakgvsasls
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.85 Rfree 0.2452
    Matthews' coefficent 2.50 Rfactor 0.19701
    Waters 320 Solvent Content 51.60

    Ligand Information
    Ligands GOL (GLYCEROL) x 2;FMT (FORMIC) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch