.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ap3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 1.6A crystal structure of a conserved hypothetical protein from Staphylococcus aureus MW2. To be Published
    Site MCSG
    PDB Id 2ap3 Target Id APC008
    Molecular Characteristics
    Source Staphylococcus aureus
    Alias Ids TPS4410,BAB94840, 1280 Molecular Weight 23874.20 Da.
    Residues 208 Isoelectric Point 9.31
    Sequence mkfgktiavvlassvllagcttdkkeikaylkqvdkikddeepiktvgkkiaeldekkkkltedvnskd tavrgkavkdliknaddrlkefekeedaikkseqdfkkakshvdnidndvkrkevkqlddvlkekyklh sdyakaykkavnsektlfkylnqndatqqgvnekskaieqnykklkevsdkytkvlnkvgkekqdvdqfk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.27188
    Matthews' coefficent 2.25 Rfactor 0.22351
    Waters 297 Solvent Content 0.45

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ap3
    1. Atomic-scale characterization of conformational changes in the preQ1 riboswitch aptamer upon ligand binding
    PM Petrone, J Dewhurst, R Tommasi - Journal of Molecular , 2011 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch