.
The Open Protein Structure Annotation Network
PDB Keyword
.

2an1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a putative kinase from Salmonella typhimurim LT2. To be Published
    Site MCSG
    PDB Id 2an1 Target Id APC23620
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS5272,NP_461613, 99287 Molecular Weight 32582.43 Da.
    Residues 292 Isoelectric Point 5.98
    Sequence mnnhfkcigivghprhptaltthemlyrwlcdqgyeviveqqiahelqlknvptgtlaeigqqadlavv vggdgnmlgaartlarydinviginrgnlgfltdldpdnalqqlsdvlegryisekrflleaqvcqqdr qkristainevvlhpgkvahmiefevyidetfafsqrsdgliistptgstayslsaggpiltpsldait lvpmfphtlsarplvinssstirlrfshrrsdleiscdsqialpiqegedvlirrcdyhlnlihpkdys yfntlstklgwskklf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.00 Rfree 0.23262
    Matthews' coefficent 2.72 Rfactor 0.19999
    Waters 542 Solvent Content 54.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2an1
    1. Analysis of the Staphylococcus aureus DgkB structure reveals a common catalytic mechanism for the soluble diacylglycerol kinases
    DJ Miller, A Jerga, CO Rock, SW White - Structure, 2008 - Elsevier
     
    2. Characterization of Salmonella typhimurium YegS, a putative lipid kinase homologous to eukaryotic sphingosine and diacylglycerol kinases
    CE Nichols, HK Lamb, M Lockyer - Proteins: Structure, , 2007 - Wiley Online Library
     
    3. Identification of NADH kinase activity in filamentous fungi and structural modelling of the novel enzyme from Fusarium oxysporum
    G Panagiotou, MA Papadakis, E Topakas, L Olsson - Process , 2008 - Elsevier
     

    Protein Summary

    Contains a Pfam NAD_kinase domain

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch