.
The Open Protein Structure Annotation Network
PDB Keyword
.

2a61

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of transcriptional regulator Tm0710 from Thermotoga maritima. To be Published
    Site MCSG
    PDB Id 2a61 Target Id APC4350
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS4602,AAD35792, 2336 Molecular Weight 16566.56 Da.
    Residues 143 Isoelectric Point 9.54
    Sequence mkqpferilreicfmvkvegrkvlrdfgitpaqfdilqkiyfegpkrpgelsvllgvakstvtglvkrl eadgyltrtpdpadrrayflvitrkgeeviekvierrenfiekitsdlgkeksskildylkelkgvmer nfskq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.80 Rfree 0.27052
    Matthews' coefficent 2.50 Rfactor 0.2097
    Waters 412 Solvent Content 49.50

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2a61
    1. Crystal structure of the MarR family regulatory protein, ST1710, from Sulfolobus tokodaii strain 7
    T Kumarevel, T Tanaka, M Nishio, SCB Gopinath - Journal of structural , 2008 - Elsevier
     
    2. Towards fully automated structure-based function prediction in structural genomics: a case study
    JD Watson, S Sanderson, A Ezersky - Journal of molecular , 2007 - Elsevier
     
    3. Structure of the N-terminal oligomerization domain of DnaD reveals a unique tetramerization motif and provides insights into scaffold formation
    S Schneider, W Zhang, P Soultanas, M Paoli - Journal of molecular biology, 2008 - Elsevier
     
    4. Protein structural classification and family identification by multifractal analysis and wavelet spectrum
    SM Zhu, ZG Yu, A Vo - Chinese Physics B, 2011 - iopscience.iop.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch