.
The Open Protein Structure Annotation Network
PDB Keyword
.

1zpq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Bacteriophage lambdacII and Its DNA Complex. Mol.Cell 19 259-269 2005
    Site MCSG
    PDB Id 1zpq Target Id APC5803
    Molecular Characteristics
    Source Bacteriophage lambda
    Alias Ids TPS4841,NP_040630.1, 10710 Molecular Weight 11055.31 Da.
    Residues 97 Isoelectric Point 9.77
    Sequence mvrankrnealriesallnkiamlgtektaeavgvdksqisrwkrdwipkfsmllavlewgvvdddmar larqvaailtnkkrpaaterseqiqmef
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.80 Rfree 0.286
    Matthews' coefficent 2.03 Rfactor 0.255
    Waters 88 Solvent Content 39.28

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1zpq
    1. Discriminative random field approach to prediction of protein residue contacts
    M Kamada, M Hayashida, J Song - Systems Biology (ISB), , 2011 - ieeexplore.ieee.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch